PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G0802
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 302aa    MW: 34359.6 Da    PI: 7.2909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G0802genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.3e-181259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++l+ +++++G g+W+t +++ g+ R++k+c++rw +yl
      Gh_D13G0802 12 KGPWTPDEDQKLLAYIEEHGLGNWRTLPEKAGLQRCGKSCRLRWINYL 59
                     79********************************************97 PP

2Myb_DNA-binding53.55.4e-1765109147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ +E++ ++++++ lG++ W+tIa++++ +Rt++++k++w+++
      Gh_D13G0802  65 RGKFSLQEEQTIIQLHAFLGNR-WSTIAAHLP-NRTDNEIKNYWNTH 109
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.556763IPR017930Myb domain
SuperFamilySSF466893.74E-318106IPR009057Homeodomain-like
SMARTSM007175.9E-141161IPR001005SANT/Myb domain
PfamPF002494.6E-161259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-241366IPR009057Homeodomain-like
CDDcd001673.50E-111459No hitNo description
PROSITE profilePS5129418.55664114IPR017930Myb domain
SMARTSM007174.4E-1664112IPR001005SANT/Myb domain
PfamPF002491.5E-1565109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-2667113IPR009057Homeodomain-like
CDDcd001671.57E-1067110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MADCREKMGL KKGPWTPDED QKLLAYIEEH GLGNWRTLPE KAGLQRCGKS CRLRWINYLR  60
PDLKRGKFSL QEEQTIIQLH AFLGNRWSTI AAHLPNRTDN EIKNYWNTHV KKRFTKMGID  120
PTTHKPKSNH VVSPTGRTTL NHMAQWESAR LEAEARLVKD SKNLPSSSSR PSPYQKSCNK  180
GSKSQCLDVV KAWQSVVAGM FATSTNNSNR IIFGPDQSSG NYELDSIIPI GGNVEDELMV  240
GNDRSKCQVP ELNERFDNYM SLHDTTHLWA APIAENDVVE GFPDFLVHDF DYQIDNEESI  300
TV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26101145108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461137.11e-137PREDICTED: uncharacterized protein LOC105781106
TrEMBLA0A0D2SAV60.0A0A0D2SAV6_G
STRINGPOPTR_0008s08870.15e-97(Populus trichocarpa)
STRINGPOPTR_0010s17300.14e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2504433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-89myb domain protein 106